DPCstruct | MC39869
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 147 ± 26 aa |
| Standard deviation of domain lengths | 25.67 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 90.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 28.65 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2K1SAJ6 | 82-212 | VEEASRWVKEEYVSALWEVNKLADDRKRSIAETLEMLTGISSAVFYQRNLRMNQVDFCTLLLEESYRSLSVYDSRITAIGPCIGALN… |
| A0A3E0NPL2 | 403-529 | DLDALLAEVEQWAIGEYATALFAGSTLDPQRREAVIGKLHRYTGLSPEYLDKADLRVSAPEFEQELLRERGLVVGRLDARFTGPTGD… |
| A0A7C3I8I7 | 2-136 | None |
| A0A847MF67 | 2-97 | None |
| A0A158D4K1 | 63-201 | None |
| A0A7V5CTD2 | 128-263 | None |
| E6D4Y4 | 12-124 | None |
| A0A4P5WL60 | 738-944 | None |
| A0A7C3BBI4 | 38-184 | None |
| A0A2A2K8P3 | 475-602 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.