DPCstruct | MC39864
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 75 ± 8 aa |
| Standard deviation of domain lengths | 7.91 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 80.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 30.12 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4P6ET15 | 3-74 | YCNIQDCLKRVKAKGLCSMHHQRMRRHGDPNIVLPRRTKLERPCTWVNCDRKATSKGLCPKHYYIHRVSVLR |
| A0A6B8RFU1 | 3-72 | SEGDGMVLCSIDGCEKAAKSKGFCANHYQKQRNAGNKPKLKIFNVKKCNAAGCETDALRLGFCQQHLKEW |
| A0A4V0HUL7 | 277-344 | None |
| A0A358IVC8 | 4-68 | None |
| A0A1V9YCN3 | 207-305 | None |
| A0A536D6S0 | 5-91 | None |
| A0A661P1E7 | 80-160 | None |
| Q3EXZ5 | 43-111 | None |
| A0A3E0PVN8 | 44-110 | None |
| A0A505DSJ0 | 37-115 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.