DPCstruct | MC39863
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 119 ± 21 aa |
| Standard deviation of domain lengths | 21.30 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 90.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 31.18 |
| Pfam Score | 54.17 |
| Assigned Pfam label(s) | CL0310- CL0311 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7K3DE30 | 4-121 | WRRPVRFRRATVLDTAWARWREAEIHAVDLDAGRRPRDWPVEFARHALDFLADRAPAGSRLLLRASDDAYALTLGTTGPTVEVSGPV… |
| A0A7Y5NGS5 | 40-142 | VPVGMVPFMRLRELVFHHVDLDAGFTFAKAPDEVVALFLRDAANRLSKEDAPPSLRIATTEGDAYTIGGGATSVTGPRAAVLTWLAR… |
| A0A7K2P5X1 | 5-99 | None |
| A0A7I8B2K5 | 2-118 | None |
| A0A544YP22 | 172-317 | None |
| A0A538DB11 | 126-309 | None |
| A0A7X0KYP1 | 6-110 | None |
| A0A4U5X1Z2 | 37-124 | None |
| A0A7V9UAE7 | 9-103 | None |
| A0A238YSC8 | 52-166 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.