DPCstruct | MC39862
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 71 ± 11 aa |
| Standard deviation of domain lengths | 10.51 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 82.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 35.75 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A374JM19 | 2-66 | QYPILLGYQVPNRTEWACWCPYCFKWHFHGEVSGHRVAHCDNPHSPLLKTGYYIKPATAKDLQFT |
| A0A7C4IEG4 | 15-93 | DAPTVPAYEWKRYHSFVFLCEHCLEWHQHAAVEGHRNAHCSNPASPYLANGYNLVRVGQIMSITQFCRHVRIGRPAVNR |
| A0A1V5X9U1 | 1-91 | None |
| A0A810NFK0 | 1-75 | None |
| X1RLY9 | 1-80 | None |
| B8IY36 | 18-90 | None |
| C2VI16 | 27-88 | None |
| W9DQM3 | 124-181 | None |
| A0A7X7KDQ1 | 48-106 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.