DPCstruct | MC39858
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 239 ± 38 aa |
| Standard deviation of domain lengths | 37.90 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 75.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 27.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P2HAI5 | 23-276 | DMRYRDASTCVDPESFMSCRHRARESRIDCVSKRCYGAEDPCTKVCNGDDTCMREKCNALQNECHRPCECVEAQDIIDCTATSCWNE… |
| A0A1S9RXV6 | 175-457 | YFNDTSVCADPKGIKKCYEKAETSYANCIMSNCSDGSKGCYDSCNGDTTCMATQCPNIGIDCINACGCVRATDQIDCTASSCWNQVY… |
| A0A132BDA5 | 15-319 | None |
| A0A6A6U5M7 | 7-288 | None |
| A0A428PR96 | 8-223 | None |
| A0A084AZS7 | 9-277 | None |
| A0A1E3Q6W5 | 13-200 | None |
| A0A2H3FMR8 | 366-574 | None |
| A0A093VA11 | 13-225 | None |
| A0A3N4L683 | 19-221 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.