DPCstruct | MC39857
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 87 ± 14 aa |
| Standard deviation of domain lengths | 14.43 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 86.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 38.23 |
| Pfam Score | 71.43 |
| Assigned Pfam label(s) | PF02698- PF01264 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P2H3T8 | 77-149 | MHSKPSHCNHLIVVCCHAIYLGGPTQGLSEDEWLLEPFQKGETPTFTAHVKAGLEVLANDPAALLVFSGGATK |
| A0A7S1BHU2 | 169-252 | KCQNLIIVAGHSVTITGHLLDADRDEKDWYLLPYQKGKGLPEAIVAHIRKGIELSTKDQKSLLVFSGGETRSKTGPVTEGSSYY |
| A0A7J7MHG2 | 1-80 | None |
| A0A813B6D4 | 76-182 | None |
| A0A7J8VZH1 | 13-103 | None |
| A0A1V6S131 | 4-91 | None |
| A0A099NTV7 | 23-135 | None |
| A0A1U8NXA0 | 1-87 | None |
| A0A6G1MFQ9 | 115-209 | None |
| R1D6V6 | 65-153 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.