DPCstruct | MC39853
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 122 ± 17 aa |
| Standard deviation of domain lengths | 17.39 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 85.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 35.20 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A368FQB8 | 2-114 | LAEARTHSNKEVRNAIMVLLAGKVSEADSLLEKGGSVYRAVMLNIIMLRWPRALDIAVKHNQFLEVVIGYRQRYLEKLGREESDEKF… |
| A0A7S3USB3 | 14-159 | MALHGNNLETAEAALAAVGEVHKLQYVLHIKHVPSVEGQNAELMLYRRQPDQAEAILLQAKPPLVYRAIKMNVRLFRWHRALELAVK… |
| A0A6J8EL41 | 122-236 | None |
| X6ML89 | 227-347 | None |
| A0A7J6QWE4 | 203-359 | None |
| A0A6T8AT66 | 2-146 | None |
| A0A5B8N042 | 827-974 | None |
| A0A7S0YCX5 | 162-282 | None |
| A0A0D2MXV8 | 401-519 | None |
| A0A6A0A6P8 | 62-188 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.