DPCstruct | MC39852
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 220 ± 29 aa |
| Standard deviation of domain lengths | 29.14 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 64.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.33 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 29.87 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11878 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183E1L4 | 1-155 | MTAADVNLIEIVEPLDVEDILSQRKNSSTIYEHSASNSNLRRVAEFPVDDVEVRLVHRDQQTVESPVPANLSSCSVDPVVRDMIRTY… |
| A0A368FPF1 | 3-233 | AADVRKHVMTGSLMMLHPASFDMTLPDGSTSQTLSLLDVVDPCDIEEALAQRRTSALYDISSTTASPRKVSEFPADDVEVRIVPREW… |
| A0A6L2Q0X8 | 36-241 | None |
| A0A804HK14 | 1-177 | None |
| A0A834B9K0 | 1-248 | None |
| A0A455B8X4 | 3-244 | None |
| A0A1S3QS63 | 19-228 | None |
| A0A0N4XGC3 | 1-216 | None |
| A0A5B7EBG5 | 28-239 | None |
| A0A3Q0GJ08 | 1-209 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.