DPCstruct | MC39850
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 61 ± 1 aa |
| Standard deviation of domain lengths | 1.14 |
| Length coefficient of variation | 0.02 |
| Mean AlphaFold2 pLDDT confidence score | 88.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 51.35 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01682 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A368FLD3 | 1-62 | MWDCVSLRHDHTECCKAKGVEGKCLEYCSAQDGVPTNYLDYLFCTESFNEIRGCFHEHLSKN |
| A0A183D321 | 102-165 | WDCASSRKDHSKCCRMVGVGPECMAYCQTTNGVPSDPAIYMNCLKYFDAVKLCFKQYLSKNPNL |
| A0A7I4KFZ3 | 127-185 | None |
| A0A6V7X0Z6 | 1-62 | None |
| A0A0N4T2I6 | 33-93 | None |
| A0A1I7U6G9 | 29-89 | None |
| A0A1I7TUW9 | 43-103 | None |
| A0A0N4Y9U9 | 169-229 | None |
| A0A0M3KEN1 | 20-80 | None |
| A0A2A2L8R8 | 279-339 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.