DPCstruct | MC39845
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 304 ± 42 aa |
| Standard deviation of domain lengths | 42.15 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 71.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 22.96 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0229 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W2SQF4 | 1-285 | MVNISEITSAPHIFEIFDISIKRLDSFDLKEEITLLAPGYCTVHWFGSERVSLASKRQVQPMFVLFFEIDRKSGNIRIRININASFS… |
| A0A368FE06 | 31-341 | EFDDDLSGKQLLTSPARLVEIGEAVNAQHIFEVVEIDIKEMESLDLKKELMEFVPSRFDRIWIDPCRVSIAGNLSSKIMLHVIFEVD… |
| A0A0B1T749 | 235-521 | None |
| G0PM14 | 288-566 | None |
| A0A0K0E5P5 | 256-589 | None |
| A0A368FV75 | 91-369 | None |
| A0A2H2ID08 | 45-412 | None |
| A0A158R3F1 | 265-565 | None |
| A0A0B1S915 | 10-296 | None |
| A0A016WJ56 | 135-409 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.