DPCstruct | MC39835
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 90 ± 14 aa |
| Standard deviation of domain lengths | 14.34 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 89.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 53.66 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0257 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S3ZAS0 | 56-144 | LNDDKYKTLRAAYSFYNVSTKTPWKELMTDALILANKAKFDVFNALNVMQNEEFMKQLKFGIGDGHLQYYLYNWNCPEMKPGDVGLV… |
| A0A368F306 | 1-89 | MHHPVHKSIRAVYSFYNVATTIPFKQLMNDALILAHKLGFDVFNALDLMQNASILEELKFGIGDGNLQYYVYNWRCPDMKPEQIGLV… |
| A0A4S9I3K8 | 75-190 | None |
| A0A818KHN6 | 91-179 | None |
| A0A4Y9YSK6 | 1-112 | None |
| A0A820CWT7 | 1-69 | None |
| A0A812W2P8 | 206-294 | None |
| A0A444UBN0 | 119-207 | None |
| A0A816EIB9 | 68-154 | None |
| A0A819X9R0 | 1-69 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.