DPCstruct | MC39834
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 71 ± 6 aa |
| Standard deviation of domain lengths | 6.24 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 44.55 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A368F2S6 | 1-77 | MLRPAKFDYILNSQHLIDRQTQEMHAWNPDDRSLNIFVKDDDCFTFHRHPVAQSTDCIRGKVSGVCPPISFRGANRA |
| A0A821EWI2 | 229-304 | PSKYFPVRLDILLDRPPVSREKQIEYGWNHDDRSMNIFVKHNDPCTFHRHPVAQSTDAVRCKKGFTSGIHVWEIEW |
| A0A183FN34 | 1-61 | None |
| A0A1X7TL94 | 87-151 | None |
| A0A183HXW4 | 129-205 | None |
| A0A834HKE8 | 14-85 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.