DPCstruct | MC39832
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 61 ± 6 aa |
| Standard deviation of domain lengths | 6.33 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 92.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.14 |
| Mean length-normalized TM-Score | 0.96 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 67.27 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0061 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q2XBB5 | 174-238 | GVPLQCSAILVREKGLMGGCNSMCAGYLFQQDKQYDVTYDTGDKAIQCGRHVDIFKFWLMWKAKG |
| A0A368EWG1 | 1-68 | MGALLQCSACLLRQDGLLFQCNQMSADYLFMQDKPYDVSFDTGDKAIQCGRHNDVFKLWLMWKSKVSY |
| A0A5E4B6R6 | 33-96 | None |
| A0A7R9AIL9 | 2-68 | None |
| A0A5C6P2A0 | 115-170 | None |
| B7QID8 | 88-151 | None |
| A0A1I8F5H9 | 920-968 | None |
| A0A1I8JH27 | 466-514 | None |
| A0A444TEH7 | 36-95 | None |
| A0A7J8JBY8 | 29-92 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.