DPCstruct | MC39830
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 116 ± 28 aa |
| Standard deviation of domain lengths | 27.83 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 76.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 26.80 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A8B3CCU1 | 23-141 | DASYVKIDHNGQALVVEAVLKPEAELQRRARAVGAEICKMAGYAESVQFYCPIYSLPQMRESEKPDVRTTVYWNPTLKIGSDGTGDI… |
| A7LQI5 | 2-88 | NNNMAIVRPIGYQQSVEFYSPVYDTPEKLKSTKPDLRSTIYWNPAVTTDEHGEAHISFYTADSSSRYRLAVEGVSAIGAIICSEQDL |
| A0A6G7BPL9 | 148-297 | None |
| A0A7Y3RYJ3 | 185-283 | None |
| A0A7Y3RZL3 | 221-357 | None |
| A0A3D3TIU8 | 225-303 | None |
| A0A413LMU0 | 4-106 | None |
| A0A088F032 | 68-211 | None |
| A0A0M3CI69 | 11-153 | None |
| A0A7V6I1T5 | 226-301 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.