DPCstruct | MC3983
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 226 ± 33 aa |
| Standard deviation of domain lengths | 32.66 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 85.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 21.86 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11750 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C1KC88 | 103-326 | LSAWLYFVLAHLIADFVLQPYELVELKRRPVGLVIHTAIHAAVTAVLVAPFVPAWPLLLPPLAVAHYLIDWWKVTASPARGPASLGF… |
| A0A372MEX2 | 3-237 | TVVFQLYLLLHILGDFYLQSEKMAGSKKTKHRAVLLHGFVYALPFLVSLVFIQPSMALINSLIFLIILHICIDTIKFLFYNHGKYKE… |
| A0A2V1HPF6 | 1-281 | None |
| W8VSW7 | 1-172 | None |
| U2J1B2 | 5-236 | None |
| A0A0P7IWS6 | 3-230 | None |
| A0A6J4M044 | 2-242 | None |
| A0A7C0X8W0 | 1-201 | None |
| A0A7X6XBI7 | 3-219 | None |
| A0A848J4X3 | 2-232 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.