DPCstruct | MC39829
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 157 ± 23 aa |
| Standard deviation of domain lengths | 22.63 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 86.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 29.93 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q8A1W7 | 2-110 | VSFLETALQQAGENRVELEKVLSHYKTDPADSLKYKAACFLIENMPYYTYYKGKQLDRYLTYYTLLQETRGLGISPQVVADSVCHMY… |
| A0A8B3C887 | 7-160 | IILLVSVLFTGISCSRNERLEAVLRLAGSNRPELEKVLDRYAADEADSLKYRAAVFLIENMPGHIGYDRTQMDSLTSLMMPVFRSST… |
| A0A077XVY4 | 2-152 | None |
| A0A412IPU4 | 4-182 | None |
| A0A7Z8KZ02 | 16-143 | None |
| A0A7T9U022 | 1-162 | None |
| A0A413N726 | 1-184 | None |
| A0A426H6S1 | 28-198 | None |
| A0A413LB76 | 4-200 | None |
| A0A1Q6G4C5 | 8-142 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.