DPCstruct | MC39827
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 130 ± 9 aa |
| Standard deviation of domain lengths | 8.80 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 90.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 33.61 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3S9EFJ5 | 1-131 | MKDARFILGHAGVRYWEDAEVNGVEDEDGTLIPGREGDRWKVKIDLPTGKVVDWPEGTTADIHYKVCDEGEYWLLDAAGNKIAYREG… |
| A0A3S0SWL3 | 1-137 | MKVKLKIEKEFEVKYLLAEVGARYWENATVNGEEDTEGTLIPCRDGEYWKPLIDIETGVITNWDKGHTASVHYKCCDDGLYKLLDEN… |
| R9H8F6 | 6-130 | None |
| A0A7W7Y4N4 | 159-285 | None |
| K5CSX2 | 13-133 | None |
| A0A1M6M084 | 2-123 | None |
| A0A1C5SC11 | 17-142 | None |
| L9LTV8 | 58-188 | None |
| A0A8B2AVR6 | 1-153 | None |
| A0A7G7TRV9 | 4-133 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.