DPCstruct | MC39821
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 195 ± 20 aa |
| Standard deviation of domain lengths | 20.14 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 33.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3D5JYS6 | 13-207 | AHKAADTTIKPLAPGLVREIVGDELGVEKGNPERINDWIALTEDQILNVLKLFNDYDWELQSWQPKPEPVYVAGGKLYSINNKVLVK… |
| A0A7X9ILY0 | 463-641 | IRPLFDDFWLRTLRELGDSRELLTEEQITLGLKRFSEANPAREFCYVASGQVFSLDKDGKLKAGQHPAARAVSWPLAHNVRPAQQAL… |
| A0A7V7D8C9 | 303-491 | None |
| A0A1Q7RDI1 | 83-297 | None |
| A0A7Y5S456 | 36-231 | None |
| A0A831V006 | 4-198 | None |
| A0A1F9P640 | 420-639 | None |
| A0A524I6D5 | 186-337 | None |
| A0A3C0VVD6 | 251-467 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.