DPCstruct | MC39820
Metacluster Properties and Pfam Annotations
| Number of structural domains | 79 |
|---|---|
| Mean domain length (aa) | 169 ± 26 aa |
| Standard deviation of domain lengths | 25.65 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 90.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 16.53 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0028 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3D5JXQ8 | 24-174 | LRKADPKGYEHMVRIYPEMGHWMKLKDAESLPWMAKFDRNPWPKRIIWRQAKGITSRFYWLQIPEKHLAKGQRVTAEVDGQSIGIAA… |
| A0A7Z9JI79 | 133-301 | VGAQDAAYDRNKIGAAWKDKLALLQQENPEGYAHQAVIHEGKGHWMDRQETKAFPWMASFTRNPHPRKIVWVQDDVLHHQFYWLPVD… |
| A0A2E1H3C8 | 686-852 | None |
| A0A518AV34 | 605-775 | None |
| A0A5N5DNA1 | 246-397 | None |
| A0A2C9JKL5 | 661-807 | None |
| A0A3D5K1K5 | 21-215 | None |
| R7ZMX8 | 163-337 | None |
| R7QBS5 | 1-162 | None |
| A0A5D0MHT2 | 476-583 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.