DPCstruct | MC3982
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 146 ± 17 aa |
| Standard deviation of domain lengths | 17.18 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 84.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 23.62 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12318 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A251ZGY1 | 2-134 | QISQKITGFEPLDVALSARYFSALNARFPQLSQHLSALYALSQQAADAQVFNQMARERGMAETIQAIVTAWYTGTVDPASVDNSQLV… |
| A0A4P2VQ52 | 7-149 | REFLSNLVMTFSVTSFAIQFSTFAEDDIDLLNKFMKISEKLTGNSELDIELGKKYLEYFMIDKNNRAKIFELHSYLNLKIPDFRKDL… |
| W5YEC9 | 4-170 | None |
| A0A4R5MHI3 | 48-200 | None |
| A0A857J1D0 | 32-191 | None |
| A0A7W9TV17 | 1-147 | None |
| A0A6I1E9R4 | 39-177 | None |
| A0A075K3J2 | 2-117 | None |
| A0A3N2R8W5 | 30-145 | None |
| A0A511B1Q7 | 3-121 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.