DPCstruct | MC39815
Metacluster Properties and Pfam Annotations
| Number of structural domains | 95 |
|---|---|
| Mean domain length (aa) | 162 ± 28 aa |
| Standard deviation of domain lengths | 27.50 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 83.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 24.11 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0142 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0J1J8S5 | 9-157 | DYKFRLVIWVTALSILGVMVVGSAQEDLMSKQIIGLILGLVCMVIISLIDYTWIMNFYWIAYLGGVILMALLPVLGREVNGAQRWIV… |
| V7I4P2 | 85-225 | AIKQVLWFIIGISAYMALVIILPDLKRFASLKYVYLVLTLVFMGMATFIGKEIYGAKNWVDLGFVSFQPSEFGKIFFVFYLASSLKN… |
| A0A640S0E5 | 46-215 | None |
| A0A822MK16 | 46-198 | None |
| A0A6H2EJ28 | 90-261 | None |
| A0A0A2WJH9 | 862-1001 | None |
| A0A377XQL7 | 4-152 | None |
| A0A6M1I8T1 | 2-130 | None |
| A4J1A7 | 9-141 | None |
| A0A2G6C786 | 2-134 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.