DPCstruct | MC3981
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 112 ± 14 aa |
| Standard deviation of domain lengths | 14.04 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 83.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 19.12 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G3K450 | 63-165 | NTYTYLRCYYPTGNRLKPTTNYVWALDPESNGYYRVRGYWWSSISSITGNMFYSDTTQVALNAVCEQTLRRRGLNPEVVMWTAANNR… |
| A0A4P2VNR0 | 7-133 | SIISLAMSPIALIHMNAQAEETTQIRCVTKDRQFFWLVDKENPGLIASVSGHWNNYLDNRSKFKYFVINGGAPMIDAIVNACTKLDP… |
| A0A833JBZ9 | 16-114 | None |
| U3C8I7 | 2-106 | None |
| A0A7U3ZFV9 | 6-119 | None |
| A0A5J6WJZ9 | 12-126 | None |
| A0A369KQ84 | 5-125 | None |
| A0A833N4T1 | 19-137 | None |
| Q2C264 | 29-120 | None |
| A0A3S1APR1 | 24-136 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.