DPCstruct | MC39806
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 103 ± 5 aa |
| Standard deviation of domain lengths | 4.96 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 93.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 29.22 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0158 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y4U8A7 | 89-187 | GLHLTLTSEWKNYRWRPVAPHDKVKGLLDPEGYMWRSERDTAKNATPQEIEIELRAQIDRAMALGIKPTHLDTHMGTLYTRKDFFDV… |
| A0A1Q7JMS2 | 1-105 | MGVHLALNSEWKGYRWGPVLGKEAVPTLVDSVGYFTPSTEQFLARKYDLGEVERELSAQVERALKSGLKISYVDYHMGTAVATPQLP… |
| A0A7K3XHS5 | 87-191 | None |
| F4L1A4 | 567-676 | None |
| A0A3E5BP26 | 82-188 | None |
| A0A133UCQ8 | 28-130 | None |
| D8F909 | 74-172 | None |
| A0A3D1TJ21 | 110-208 | None |
| A0A3A0DXM2 | 127-230 | None |
| A0A388NVY0 | 16-115 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.