DPCstruct | MC39802
Metacluster Properties and Pfam Annotations
| Number of structural domains | 56 |
|---|---|
| Mean domain length (aa) | 172 ± 28 aa |
| Standard deviation of domain lengths | 27.54 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 88.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 15.02 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14136 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T5GLB0 | 77-259 | AVADDAKPGRKANMDWDDIAEQLEQAVLSAFDDLAIAVEERCLYALALVTEDGAMGVGIAANTEEAVQERFEAELQENADFSPQDGA… |
| A0A3N1TD02 | 1-195 | MTFHDHLRHLAESALASIPAAEAQDIYVVSFFIDNEADDPRQPTLTIGYNTEAQFRHTIADASDEAEARWNYAFWLQNELTVIADLT… |
| A0A2W1LZ20 | 50-267 | None |
| A0A517PNU3 | 139-296 | None |
| A0A357IJW6 | 215-374 | None |
| A0A373Q6H2 | 3-184 | None |
| K2J8T3 | 10-226 | None |
| A0A396ZFE3 | 302-432 | None |
| A0A0M8YKX8 | 1-166 | None |
| R6UDH7 | 11-188 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.