DPCstruct | MC3980
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 73 ± 8 aa |
| Standard deviation of domain lengths | 8.17 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 82.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.51 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 61.78 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02312 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A452V371 | 1-70 | MILNGVCVIWKGWIDLQRLDGMGCLEFDEERAQQEDALAQQAFEEARRRTREFEDRDRSHREEMEVRVSQ |
| A0A0L8GGC7 | 13-90 | FIMNGVCVIWRGWIDLHRLDGIGCLEFDTERAEVEDAILREQTDQYNRRIRGFEERQRQFREQEVRRTEAEVHSHSSD |
| A0A0J7KAS2 | 1-67 | None |
| A0A060X8P0 | 1-70 | None |
| A0A498MAS0 | 112-188 | None |
| A0A4Y2TPK9 | 1-72 | None |
| A0A7R9KG14 | 1-69 | None |
| A0A4Y2UCU0 | 1-57 | None |
| A0A3Q4N2B1 | 89-166 | None |
| A0A674GAQ5 | 296-380 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.