DPCstruct | MC39798
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 93 ± 9 aa |
| Standard deviation of domain lengths | 8.62 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 82.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 27.27 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2K5DLH7 | 1-86 | INPLEVAPKSYVIHDSQKMMWVLSGNSLIAPPLSRSVKPVALDLIACRDREFGDEKKGNVVYLGIKGKELCLFCAEIQDKPTLQLQ |
| A0A7J7FDS7 | 1-107 | MATPQSLETPQFLHIRDSLQMVWVLKGNSLIAVPSSNNVKPVILALVSCTDQKLKKEEKDNLVYLGIRGMNLCLFCAEIQGQPTLQL… |
| A0A6P9DNM1 | 23-106 | None |
| A0A674JFT3 | 1-95 | None |
| A0A674GG65 | 8-106 | None |
| G1QN82 | 1-84 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.