DPCstruct | MC3979
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 259 ± 59 aa |
| Standard deviation of domain lengths | 59.02 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 74.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 40.02 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF21178 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3S5FGP5 | 4-166 | ISLLQSPKEGKFAVIGSAHMFSDNYLNKEDNSKIFDVLFTFLTTSDGVHFDPIDAEDPDIETYFQVPDISSLGDQLKACLQESDEVP… |
| A0A671K576 | 12-218 | YPYGATLNVMKPAVAVLSTGSVCFPLNRPVLAFHQSKNAGKLAVLGSCHMFSDQYLDKEENSKIMDVVFQWLTTDSIPLNQIDAEDP… |
| A0A226NT92 | 276-603 | None |
| A0A0K0EE25 | 157-448 | None |
| A0A3Q3X5C6 | 115-391 | None |
| A0A2P4SMP4 | 12-330 | None |
| A0A7G2CCG2 | 22-243 | None |
| A0A2G9R8L8 | 6-263 | None |
| A0A1W0A6I4 | 118-455 | None |
| D7FI94 | 217-539 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.