DPCstruct | MC39789
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 87 ± 1 aa |
| Standard deviation of domain lengths | 0.88 |
| Length coefficient of variation | 0.01 |
| Mean AlphaFold2 pLDDT confidence score | 90.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 53.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P8YXU3 | 35-121 | KQKEKEINTEFFGTDAMINTQWMKSNQPQRHAIVGLAIHGYHHLMCTNKKFHQPNDQCVCESCEKPCEQYHYDKCKKRSRSLRELIR |
| A0A2P8ZEM1 | 63-150 | NGKREEIHPDFYSTGAMVDRAWTKENFEMRHVITRLAVHGFHHLICKNTKFHDPNTDCRCMLCDKKCDRYHIELCTKRSKTICEYAKM |
| A0A2P8YUA1 | 104-191 | None |
| A0A2P8YMI7 | 24-111 | None |
| A0A2P8XZM8 | 723-808 | None |
| A0A2P8XIB2 | 98-183 | None |
| A0A2P8ZEL0 | 240-327 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.