DPCstruct | MC39787
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 135 ± 19 aa |
| Standard deviation of domain lengths | 19.15 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 77.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.81 |
| Mean length-normalized TM-Score | 0.38 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 40.18 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06625 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P3XUT4 | 152-264 | MAPVLGVPPPPPPAPHMGPDGLILPKKPYNPCLTSTNHKDLHRELLFNQKIGRNVLNQKSELQRALERQREAASRREAERNREESYK… |
| A0A2P8ZM37 | 58-204 | NMIPEPELCTSGADLEKRNRRNNVGPVAPPLPSHNPEGLILPRKPQNPYHESSDHKNLHRELLFNQKIGKNVLNQKSELQRALEKHK… |
| J9K1K2 | 80-245 | None |
| A0A444SYG8 | 58-185 | None |
| A0A834J9H6 | 5-112 | None |
| A0A6H5IL51 | 7-109 | None |
| A0A7J7UIV0 | 2-141 | None |
| A0A6J2U694 | 80-216 | None |
| A0A384AZC6 | 9-172 | None |
| A0A6I9JHK6 | 29-172 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.