DPCstruct | MC39780
Metacluster Properties and Pfam Annotations
| Number of structural domains | 112 |
|---|---|
| Mean domain length (aa) | 185 ± 54 aa |
| Standard deviation of domain lengths | 54.29 |
| Length coefficient of variation | 0.29 |
| Mean AlphaFold2 pLDDT confidence score | 79.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 22.01 |
| Pfam Score | 92.46 |
| Assigned Pfam label(s) | CL0266- PF00334 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P8Z3A3 | 134-312 | DEFLESQGIELNEPEEMPPDPYIQYRRLKVKPHTHITKPLDDKLRRFLEYDGKILRFFAVWDDRETEYGEMRAYVIYYYLADDRVEV… |
| A0A556VYB2 | 31-135 | LREERFAFLAEWYDPSAALLRRYQLLYYPKDGSVEMFDVKNQRIFLRRTKYDDLHSEDLFVGNRVIVFSRQLSLVDYGDQYTANKLG… |
| A0A2H2I1Q6 | 49-200 | None |
| A0A0R3Q9Z5 | 38-257 | None |
| A0A0R3QSY2 | 1-103 | None |
| U6KZS5 | 18-162 | None |
| A0A7S3ZJU8 | 3-148 | None |
| A0A1D2NKR0 | 185-503 | None |
| A0A061RIM0 | 37-300 | None |
| A0A2J8AK73 | 2-106 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.