DPCstruct | MC3978
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 134 ± 11 aa |
| Standard deviation of domain lengths | 11.15 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 87.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 35.76 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12960 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6S6XJR4 | 3-131 | PVYKYPAAYAREHGELEQYRASHKENVACKDAIEIAIRDNYRDNRLGKEGVKQVADQFSYERMFYVLANTAQRKDFDGRISRDNKDW… |
| A6NZN8 | 103-242 | QAELRKATIYPHSAAYAKEHGELEQYRASNNANLQCKEAIETAVREHFDGMYLSHDAAKGVIETYGMDRVMLVLANTVQLQDWDGRY… |
| A0A1Y4S486 | 146-278 | None |
| A0A315XT30 | 4-128 | None |
| N2AP23 | 37-189 | None |
| A0A7X3MCU4 | 137-272 | None |
| A0A415FG32 | 57-193 | None |
| A0A564WKC3 | 249-380 | None |
| A0A351TLH3 | 4-144 | None |
| A0A1F8V802 | 4-136 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.