DPCstruct | MC39776
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 130 ± 11 aa |
| Standard deviation of domain lengths | 11.18 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 70.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 38.25 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A654GVM6 | 1-128 | MLQYQNGGLLNVFLKPVPSSGSQNGTSFDIQKDASVMTTNVLHMVMGRLEKADLAVLAALPEDLGGGEAGVQEAIANPNREGQLMIA… |
| A0A5K3FY22 | 1-130 | MALEVTLMSVVAAIMVWAIRVENGGVLNTVFQVVPTTPQGTVEFDLSSDLMKSNADFFMSALLLKPIPLPVLKVMPESLGGGASGVA… |
| A0A3P7LDC4 | 1-139 | None |
| A0A5K3FKG7 | 1-138 | None |
| A0A3P7N555 | 1-144 | None |
| A0A183T2R6 | 5-133 | None |
| A0A0R3SXX5 | 2-104 | None |
| A0A158R8U5 | 4-148 | None |
| A0A0R3WG92 | 4-122 | None |
| A0A0R3WFY1 | 438-567 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.