DPCstruct | MC39772
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 108 ± 10 aa |
| Standard deviation of domain lengths | 10.41 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 78.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 38.53 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0251 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A654GK07 | 123-221 | IDGLEYNEEFWTYCDGHDRRFYTEILNGLQPAGRTNLTNGPTRKIPPHCYDTGDGFYDPKHKIVFDYEMNFLRNADHEEHEWITKNC… |
| A0A6J0TLN6 | 32-136 | GKYTFADGLEYQDERWHYCDGYDRRFYTEICNGLKPAGKSQLTNLDPPRMIPPGCYDCGDGFYNPETRVVTDYHHRFLRNADDDEHD… |
| A0A812UI20 | 4-115 | None |
| A0A5D6XRF8 | 237-334 | None |
| A0A6I8P061 | 179-285 | None |
| A0A1I8IMM3 | 67-169 | None |
| A0A6A4JLK7 | 582-691 | None |
| A0A7E4SCW4 | 201-330 | None |
| E2BRP3 | 30-114 | None |
| A0A455AXH9 | 49-155 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.