DPCstruct | MC3977
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 108 ± 7 aa |
| Standard deviation of domain lengths | 6.95 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 87.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 19.13 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3R6QMP2 | 1-104 | MTQTITLSKKEMDLINNLLGLTGSEIYQKYGYKRDEAITHTAKFPDGIEIDIKLVICEDDTPYTEGVLFQNGCEQTGTEPGYAYDGK… |
| A6NWL6 | 109-209 | CTAEMEIPRDAMEQINSYLHAASEDAYQSEDHTITYTVQFPDGKQMDIKCCGCQDEPSWTEAVLFDEDGSQLCCTEPGDSFDGPWEL… |
| D4JPX8 | 46-157 | None |
| A0A6I2RBY1 | 1-104 | None |
| A0A1Y4GX05 | 1-108 | None |
| A0A1Y4GWG2 | 5-110 | None |
| A0A1Y4EYL8 | 264-374 | None |
| A0A7X2NKY1 | 1-127 | None |
| A0A1Y4B546 | 93-207 | None |
| A0A1W1WMU0 | 4-110 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.