DPCstruct | MC39769
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 155 ± 12 aa |
| Standard deviation of domain lengths | 12.48 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 88.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 16.12 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A328KSC9 | 2-176 | PKRVNRDTEVVIVNNTKGGFSERIPGGISIVLNEYGDTAYINHGELVKLVGRGRAGRRKFEKMDIVISEVVTDGVTIKNITDELRLT… |
| A0A0F5RV07 | 59-202 | FDDNRIVLVMNGTSSKVSYDSDITNKTYVFIDHGDLQNMDYKELAEIKRRFPRYIDDGWIIIMDQDVKEQLGQAENIGIEPREVERL… |
| A0A374DWZ3 | 39-192 | None |
| A0A7X8XIM1 | 15-165 | None |
| A0A316L2C3 | 99-262 | None |
| A0A843FVU6 | 4-149 | None |
| A0A853Y0I7 | 4-136 | None |
| A0A2W6PCU7 | 1-175 | None |
| A0A6B5A1E8 | 5-166 | None |
| A0A1V5S749 | 1-151 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.