DPCstruct | MC39766
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 148 ± 17 aa |
| Standard deviation of domain lengths | 16.75 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 83.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 26.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11369 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V3JSY8 | 14-162 | ILSRLIEISKTELENRELTDDDYDFIKYFGEQLEFINASLLQKSYENEIDPDMFKTTIINEIDPDMFKTTIIADVHTDGNTQKVLQV… |
| A0A7C6NCW9 | 40-193 | LNERDLESLNRMEQLILDLKTISEKELTNTPLTDEEYDLIRSYGGQLEHFWLEALRDEGIDHRSAIYDRPAALVADVANDPNGRVLE… |
| A0A662JPK9 | 15-141 | None |
| A0A0E3SDH9 | 147-288 | None |
| A0A5C6D458 | 157-316 | None |
| A0A080Z8H2 | 1-114 | None |
| A0A661PJH8 | 539-681 | None |
| A0A661AVC5 | 618-763 | None |
| A0A660SGM9 | 473-603 | None |
| A0A7V9RFU0 | 219-390 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.