DPCstruct | MC39763
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 212 ± 27 aa |
| Standard deviation of domain lengths | 26.62 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 79.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 39.30 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0163 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0L0JTZ6 | 23-260 | RQLMPEKTEKVSWLDPRTLWAARNGVVASWLGDPTGRTRSRWVAQQQAQQKAPADKVIRRDDPDRFSFMVIGDTGEGDDPQYAVVPG… |
| A0A7V3F7M7 | 17-227 | SPLAASSRSTSRIYEAKMGGWYDISQLVQTAVQVLTSTLFGRHADHRLLEALAHDGEEIYDHTHHGQDVDSDQRHPNEGQASKAFWF… |
| A0A7Y1U359 | 1-179 | None |
| B8BXD1 | 44-305 | None |
| A0A1D6EM38 | 35-246 | None |
| A0A024FXD4 | 17-190 | None |
| K0RW91 | 337-603 | None |
| A0A7J6F6K3 | 339-556 | None |
| A0A7N2KRW9 | 94-281 | None |
| A0A2K2DSF7 | 204-419 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.