DPCstruct | MC3976
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 181 ± 16 aa |
| Standard deviation of domain lengths | 16.30 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 18.17 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2S7TAI6 | 2-165 | DEFLDELHKFNKNIYFEIGGHPEDEKVELIISAEGNVEYFASVEKLTSLAPEFKNWDIIAFKPPMGTGFSLDYGGRVFNPEEIIFIP… |
| A6NUL8 | 436-621 | FAEMESELRQMMDDDKDHTHGAELVAQMQETLNLVFDEISFEMGFNGEKHELILTPEGNKVKLFELIYFLKHAPKEVLEHWNILVGR… |
| A0A2X0WU19 | 144-326 | None |
| A0A1G0CJN6 | 10-199 | None |
| A0A7H0LF16 | 10-176 | None |
| A0A2W4IIC8 | 71-260 | None |
| A0A1T4YUV2 | 3-159 | None |
| A0A286INW9 | 7-180 | None |
| A0A2Z6IBR4 | 491-688 | None |
| A0A2Z6IF09 | 50-243 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.