DPCstruct | MC3975
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 127 ± 12 aa |
| Standard deviation of domain lengths | 12.16 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 66.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.50 |
| Mean length-normalized TM-Score | 0.36 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 43.51 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0208 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C6N985 | 9-131 | ISLDAFFNNRISAETKHLILSKLEEQVEANMGTAMMYTLFEWAKENQEELMENHKPVVTVANISSSNEMLTTRLAAKKDKKEHLTKA… |
| A0A1A8VBZ3 | 1-151 | MFAVYLVLRRSKVTCFLSFIVIVLRELTSPLCWFENSSAETKELILSKLEQQVEANLGTAMMYTLFEWAKEHQEVLMENHRPVVTSV… |
| A0A183B7Y8 | 137-276 | None |
| A0A7J8DZE3 | 2-116 | None |
| A0A3B4F769 | 10-134 | None |
| A0A336KU13 | 2-120 | None |
| A0A6L2PIC1 | 173-291 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.