DPCstruct | MC39744
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 85 ± 2 aa |
| Standard deviation of domain lengths | 2.37 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 86.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 47.13 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08295 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U5P9G9 | 455-540 | RTEEERFELDIVMEVNKSAIKLLTYIENEMKTMKPDELAKLRYDDKFLGKSSSLMRRALKRLYGEHANKILDGLMYSPSVAIPRVL |
| A0A060Z3J4 | 68-153 | RCEDERFELDVVLETNLATIRALEAVQRRLSRMTAEEQVKFRLDNTMGGCSEVIHRKAIQRIYGDKAADIIDGLKRNPAVSVPIVL |
| A0A0V1D2X1 | 569-651 | None |
| A0A2I0TEN0 | 52-137 | None |
| A0A2I0T3M5 | 33-118 | None |
| A0A6J3CBY4 | 85-170 | None |
| A0A821G5D6 | 1-79 | None |
| A0A6I9Q1V0 | 152-237 | None |
| A0A183DYV7 | 72-157 | None |
| A0A0R3QY57 | 208-293 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.