DPCstruct | MC39742
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 247 ± 11 aa |
| Standard deviation of domain lengths | 10.83 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 66.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.59 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 54.06 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0680- PF18436 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A182G7F3 | 351-590 | PAWEARMDSHGRIFYIDHATRTTSWQRPGAHAINGPEQHRQQLDRRYQSIRRTIYDRRDGGSRSPPRFGFEPINPRQGASAIAVAIN… |
| A0A6I9PHZ2 | 1-252 | MIILPDWEARIDSHGRIFFVDHVNRTTTWQRPTGPPAPQGLTRSNSIQQMEQLNRRYQSIRRTITNSDRPEENPVDLPPEPESELMP… |
| A0A669ENA6 | 417-668 | None |
| D4ADD3 | 813-1063 | None |
| A0A182FK02 | 555-819 | None |
| A0A4Z2E3Y0 | 1-224 | None |
| A0A3B4H239 | 307-546 | None |
| A0A672L874 | 572-824 | None |
| A0A3Q3J489 | 321-569 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.