DPCstruct | MC39740
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 238 ± 30 aa |
| Standard deviation of domain lengths | 29.65 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 74.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 22.30 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M7Q468 | 142-377 | WYTILDLKNHIAAQLDSDNDGIRICCIKFLEVLILCMSERLKESIILHTNRSDFSVDQLEQDESELFNREDMKEEGRYHLKKLLEYT… |
| A0A6I9PHK8 | 1-205 | MVTQMKGDVLALLDSENDGVRTHAIKFTESLIITLSPRTSDSDVPKRQEGDISLDKVPRDHSYIRYSALCEEGKAALEKLLKFMVHP… |
| A0A2K1JPI8 | 135-380 | None |
| A0A137NQW0 | 2-200 | None |
| A0A0K0DL78 | 147-398 | None |
| T1F0X8 | 62-348 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.