DPCstruct | MC3974
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 81 ± 8 aa |
| Standard deviation of domain lengths | 7.96 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 51.24 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A120HMM4 | 1-81 | MNFQVTVLKILVAYPDGFAAMEDLKRDMAILATSGRDWADRTRRLAARVPDLDIFCQGLVERISGGWKITARGRQVLQFME |
| A0A1M6VUB4 | 1-86 | MSLQFTILMVLYGQPEGRASLQDLKRYVAILMTSGPDWAERMKGLAARAPRLDIFGQSFVTRDRDGWAITEAGKAFLAAIERPIRD |
| A0A0R3MCQ1 | 1-81 | None |
| A0A2S6M8H3 | 1-90 | None |
| A0A0R3N039 | 1-88 | None |
| A0A160UC10 | 1-64 | None |
| A0A7W6X5V3 | 74-154 | None |
| H5Y7T3 | 1-87 | None |
| A0A0D7Q050 | 1-88 | None |
| H7C6T7 | 15-82 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.