DPCstruct | MC39725
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 206 ± 30 aa |
| Standard deviation of domain lengths | 29.92 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 73.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 27.89 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20499 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J2RBY8 | 124-335 | QLPLKVNVPRGPRVKVKTPDEVEAEAKALVLSEGGDPSNESLVLSRHKLQFGKYKGKTFQWLLENNVGYIAYLVNSHQKDERDPMHQ… |
| A0A1A8D4M6 | 19-239 | QAVLLATKESRLYRDQKLWLPVPHPELLYQATALECAEKLLRADGVSSPTRQQRLGKLVLPFGQYQNAPFHWLVENDVGYMKYILDK… |
| A0A498LZ09 | 2-145 | None |
| A0A6P6PBZ8 | 3-205 | None |
| A0A6P6PII4 | 1-172 | None |
| A0A2I4C9D9 | 2-217 | None |
| A0A498P0D6 | 36-228 | None |
| A0A6P8T3I4 | 3-226 | None |
| A0A6P8TNZ9 | 1-285 | None |
| A0A3S2UAH0 | 6-227 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.