DPCstruct | MC39724
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 160 ± 9 aa |
| Standard deviation of domain lengths | 8.63 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 91.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 47.75 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0260 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1M6X8M3 | 7-178 | KNAYENIKKECDARLAEIYPFGIPKVAKERYEKELEYLKTSEYLDEYELFRQLSGCCKKSSLTLILRGTDAGSYLVYLMRNSLLNPL… |
| A0A2P1G447 | 4-152 | KEMIYDAANEKYPSCDYVYKRLEKEIKYFEESGFLNELEKIIELKNIIKIDNILITYAPFLSFYLLDLMIFNPLPAHYYDEKSKEVT… |
| A0A835G1I0 | 665-825 | None |
| A0A7C7E1W8 | 525-689 | None |
| A0A3D2TSR6 | 636-795 | None |
| T0CMF9 | 152-325 | None |
| A0A420Z0Q2 | 137-294 | None |
| A0A829GJ96 | 621-781 | None |
| R7IJV9 | 412-551 | None |
| A0A4V1S4H2 | 365-524 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.