DPCstruct | MC39722
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 82 ± 9 aa |
| Standard deviation of domain lengths | 9.38 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 90.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 33.96 |
| Pfam Score | 93.75 |
| Assigned Pfam label(s) | CL0486- PF04267 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| U1X283 | 3-82 | RPELEFAYAGEAHIARPADPSTLSDDEWRDFLFTRSNPRGTHFERWRHINGCGRFFNAVRDTVSDKFAMTYKAGEPRPAL |
| A0A328XW45 | 4-90 | IFCPYCGEHREEEEFHPKGQAHIARPADPESTSDDEWGDYLFFRDNPRGVHHELWVHAVGCRKFFNITRHTVSYEILEVYKMGEQPS |
| A0A429YWG1 | 4-90 | None |
| A0A1G7WG48 | 4-101 | None |
| A0A2A4ZPA3 | 3-76 | None |
| A0A7R7HB13 | 4-93 | None |
| A0A0K6I4S4 | 1-95 | None |
| A0A2S6VRL8 | 46-123 | None |
| A0A3B0TLQ9 | 1-95 | None |
| A0A258ZUC9 | 1-77 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.