DPCstruct | MC3972
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 110 ± 13 aa |
| Standard deviation of domain lengths | 13.13 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 91.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 22.05 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Z9D743 | 3-126 | VVERTQNLCTALENDYKEHSRQMYLRNPSDYSLKQLNAIDDGSAKLTKFRIQSGRKYYKLIQQDYDTFQNRNEYRDGGVHAFVDKKT… |
| A0A381WEH7 | 21-124 | VLKGVDDYLKIAREKIKRHPQFANLYRDQRRDVATSVGGKYIKIWDTERGQKRSIHAFVDKVTGDVLKAAGINAPAKGARGNVLDRK… |
| A0A5C7PW62 | 1-104 | None |
| A0A382PBI0 | 5-149 | None |
| A0A5C8AWZ1 | 9-117 | None |
| A0A0F9QBW7 | 3-102 | None |
| A0A661HJ23 | 92-189 | None |
| A0A382TCI9 | 1-121 | None |
| A0A2E5B9I1 | 23-120 | None |
| A0A382BT03 | 1-100 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.