DPCstruct | MC39718
Metacluster Properties and Pfam Annotations
| Number of structural domains | 105 |
|---|---|
| Mean domain length (aa) | 109 ± 19 aa |
| Standard deviation of domain lengths | 19.06 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 83.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 37.82 |
| Pfam Score | 98.63 |
| Assigned Pfam label(s) | PF00183- CL0025- CL0540 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R7QF84 | 7-117 | DQDQIYYHSGADLESVKDSPFLEKLIKKGYEVLYLTQAIDENMTTQLLDYEGTKFMSISKDNFKFGEKDQKEEKEKNKALKKMYKPL… |
| A0A2I3SNK2 | 388-496 | QKSIYYITGESKEQVANSAFVERVRKRGFEVVYMTEPIDEYCVQQLKEFDGKSLVSVTKEGLELPEDEEEKKKMEESKAKFENLCKL… |
| A0A6I8NVF5 | 112-224 | None |
| W0BEV1 | 147-277 | None |
| K8EXD6 | 959-1074 | None |
| C1FHV5 | 534-671 | None |
| A0A812NC36 | 432-548 | None |
| A0A5K4FAB9 | 399-533 | None |
| A0A7T7FRM2 | 534-656 | None |
| A0A146KBC5 | 453-587 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.