DPCstruct | MC39716
Metacluster Properties and Pfam Annotations
| Number of structural domains | 56 |
|---|---|
| Mean domain length (aa) | 94 ± 16 aa |
| Standard deviation of domain lengths | 16.04 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 91.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 29.65 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0172 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H6ENI7 | 10-93 | FNFPYLRDNNQSVARLYGATHTPEIFLFNKDRKLVFHGKIDDNWKEPEKVKSKYLKNALDDLLSNKVIAVPETFTIGCTIKWQT |
| A0A800F1N1 | 1-62 | PDFYLFDSELKCVYRGQLDDSRPQTDIPVNGKDIRKALDKVLSGEPIDPDQKPSLGCNIKWK |
| A0A7X7DHE9 | 18-83 | None |
| A0A067GVK6 | 7-62 | None |
| A0A4R7A435 | 91-185 | None |
| A0A354T490 | 245-347 | None |
| A0A4Q2Y0G1 | 11-92 | None |
| A0A2E8K296 | 129-216 | None |
| L0DGP5 | 95-199 | None |
| A0A2H0PC78 | 56-158 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.