DPCstruct | MC39709
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 134 ± 15 aa |
| Standard deviation of domain lengths | 15.33 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 72.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.54 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 45.87 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A521LPF8 | 1-113 | MSQAIHPAAASTHLPAFLAGPGETDWLLVAMGIFLVIFVLAIGILYLHLHVLPDRIAHNKVQLQIVCVLGLLAMFTHMHIFWIAGLI… |
| A0A2A6M9U3 | 1-144 | MEESLHPAAADHLPPFITAPGQTDVLFNVMAVFVLLMIFLVGILYLRLHALPEHMAHGASKAQLQIVGALGLIALFTHNHLFWIAAL… |
| A0A7W8U7B1 | 1-145 | None |
| A0A1E3VRP7 | 68-182 | None |
| A0A3D0CAY8 | 2-111 | None |
| A0A395L2T2 | 1-153 | None |
| A0A537L932 | 9-150 | None |
| A0A239GMY4 | 1-126 | None |
| A0A4Q1UZM5 | 15-164 | None |
| A0A1Q3NTF7 | 35-171 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.